GATE BT 2015 Question Paper & Solutions

Verbal Aptitude

sentence. Choose the most appropriate word from the options given below to complete the following The principal presented the chief guest with a _ as token of appreciation

Verbal Aptitude

Choose the appropriate word/phrase, out of the four options given below, to complete the following sentence: Frogs

Verbal Aptitude

Choose the word most similar in meaning to the given word: Educe

Quantitative Aptitude

Operators O, V and → are defined by: a D b = - a-b a+b a+b: alb= a-bi arb=ab. Find the value of (66 0 6) - (66 0 6).

Quantitative Aptitude

If log_x (5/7) = -1/3, then the value of x is:

Verbal Aptitude

The following question presents a sentence, part of which is underlined. Beneath the sentence you find four ways of phrasing the underlined part. Following the requirements of the standard written English, select the answer that produces the most effective sentence. Tuberculosis, together with its effects, ranks one of the leading causes of death in India.

Quantitative Aptitude

Read the following paragraph and choose the correct statement. of human progress is that human security largely depends upon environmental security. But on the Climate change has reduced human security and threatened human well being. An ignored reality contrary, human progress seems contradictory to environmental security. To keep up both at the required level is a challenge to be addressed by one and all. One of the ways to curb the climate change may be suitable scientific innovations, while the other may be the Gandhian perspective on small scale progress with focus on sustainability.

Analytical & Spatial Aptitude

Fill in the missing value 6 5 4 4 7 2 9 2 8 1 80 4 1 5 2 3 3

Analytical & Spatial Aptitude

A cube of side 3 unts is formed using a set of smaller cubes of side 1 unt. Find the proportion of the number of faces of the smaller cubes visible to those which are NOT visible.

Verbal Aptitude

Humpty Dumpty sits on a wall every day while having lunch. The wall sometimes breaks. A person sitting on the wall falls if the wall breaks. Which one of the statements below is logically valid and can be inferred from the above sentences?

Downstream processing (chromatography, filtration)

Which one of the following complement proteins is the initiator of the membrane attack complex? (А) СЗа (В) СЗЪ

Cell structure and signaling

Levinthal's paradox is related to

Biomolecules, enzyme kinetics

Which one of the following is a second generation genetically engineered crop?

Biomolecules, enzyme kinetics

Based on the heavy chain, which one of the following antibodies has multiple subtypes?

Cell structure and signaling

The cytokinetic organelle in plant cells is

Cell structure and signaling

In immunology, anergy refers to a state of immune unresponsiveness where:

Cell structure and signaling

ABO blood group antigens in humans are differentiated from each other on the basis of

Biomolecules, enzyme kinetics

Which one of the following organisms is used for the determination of phenol coefficient of a disinfectant?

Biomolecules, enzyme kinetics

A single subunit enzyme converts 420 umoles of substrate to product in one minute. The activity of the enzyme is × 10-6 Katal.

Biomolecules, enzyme kinetics

Which one of the following amino acids has the highest probability to be found on the surface of a typical globular protein in aqueous environment?

Biomolecules, enzyme kinetics

Which one of the following is NOT a product of denitrification in Pseudomonas?

Linear Algebra

[3 0 0 The determinant of the matrix 2 5 6 -8 -60

DNA replication, transcription, translation

Which one of the following features is NOT required in a prokaryotic expression vector?

Biomolecules, enzyme kinetics

Production of monoclonal antibodies by hybridoma technology requires

Downstream processing (chromatography, filtration)

Which one of the following is INCORRECT about a typical apoptotic cell?

Media Sterilization and Stoichiometry

Identify the file format given below: >P1; JMFD Protein X - Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL

Microbial growth kinetics

Which one of the following relations holds true for the specific growth rate (p) of a microorganism in the death phase?

Biomolecules, enzyme kinetics

How many 3-tuples are possible for the following amino acid sequence? MADCMWDISEASE

Biomolecules, enzyme kinetics

acids? How many different protein sequences of 100 residues can be generated using 20 standard amino

Biomolecules, enzyme kinetics

In DNA sequencing reactions using the chain termination method, the ratio of ddNTPs to dNTPs should be

Biomolecules, enzyme kinetics

In a Lineweaver-Burk double reciprocal plot (1/v vs 1/[S]), uncompetitive inhibition is represented by curves that:

Recombinant DNA technology

Choose the appropriate pair of primers to amplify the following DNA fragment by the polymerase chain reaction (PCR). 5' - GACCTGIGG- 3' -CTGGACACC- --ATACGGGAT- 3' - TATGCCCTA-5' Primers P. 5' -GACCTGTGG-3' Q. 5'-CCACAGGTC-3' R. 5' -TAGGGCATA-3' S. 5' - ATCCCGTAT-3'

Biomolecules, enzyme kinetics

Consider the following infinite series: 1+r+r2+13+..........00 If r = 0.3, then the sum of this infinite series is 1.40 to 1.43

Linear Algebra

2x1 + x2 = 3 5x1 + bx2 = 7.5 The system of linear equations in two variables shown above will have infinite solutions, if and only if, b is equal to 2.5

Cell structure and signaling

The interaction between an antigen (Ag) and a single-chain antibody (Ab) was studied using Scatchard analysis. The result is shown below. Y (Ab-AgI* [Ag] → X [Ab-Ag] - The affinity of interaction and the total concentration of antibody, respectively, can be determined from

Classical Genetics and Epistasis

An isolated population on an island has the following genotypic frequencies: Genotype AA Aa aa Frequency Q.4 Q.3 Assuming that there are only two alleles (A and a) for the gene, the genotypic frequency of AA in the next generation will be Q.25

Mass transfer in bioprocesses (kLa)

How many rooted and unrooted phylogenetic trees, respectively, are possible with four different sequences?

Bioenergetics and Metabolism

Match the compounds in Group I with the correct entries in Group II Group I Group II P) Cyanide 1) K' ionophore Q) Antimycin A 2) Electron transfer from cytochrome b to cytochrome c R) Valinomycin 3) Fi subunit of ATP synthase S) Aurovertin 5) Adenine nucleotide translocase 4) Cytochrome oxidase

Linear Algebra

What are the eigenvalues of the following matrix? Lz 41

Probability and Statistics

shown below: For a discrete random variable X, ran(X) = (0, 1,2,3) and the cumulative probability F(X) is 3 F(X) 10.5 Q.6 08 1.0 The mean value of X is 1.1

Mass transfer in bioprocesses (kLa)

Match the drugs in Group I with their mechanism of action in Group II. Group 1 Group I P) Paclitaxel 1) Inhibits protein translation Q) Colchicine 2) Inhibits microtubule depolymerization R) Etoposide 3) Inhibits DNA replication S) Methotrexate 4) Alkylates DNA 5) Inhibits dihydrofolate reductase 6) Inhibits microtubule polymerization

Biomolecules, enzyme kinetics

The limit of the function (1 + 3)" as n → 0o is

Cell structure and signaling

Match the cells in Group I with their corresponding entries in Group Il Group I Group II P) Mast cells 1) Activation of the complement pathway Q Natural killer cells 2) Expression of CD56 R) Neutrophils 3) Contains azurophilic granules S) Dendritic cells 4) Defense against helminthic infection 5) Production of antibodies specific to bacteria 6) Contains long membranous projections

Bioreactor types, scale-up

oxygen tension was found to be 80% air saturation under steady state conditions. The measured Oxygen transfer was measured in a stirred tank bioreactor using dynamic method. The dissolved oxygen tensions at 7 s and 17 s were 55% and 68% air saturation, respectively. The volumetric mass transfer coefficient KLa is _ Q.065 to 0.078

Biomolecules, enzyme kinetics

Match the microorganisms in Group I with their fermentation products in Group II. Group I Group I P) Leuconostoc mesenteroides 1) Cobalamin Q) Rhizopus oryzae 2) Sorbose R) Gluconobacter suboxydans 3) Dextran S) Streptomyces olivaceus 4) Lactic acid 5) Butanol

Recombinant DNA technology

Plasmid DNA (0.5 kg) containing an ampicillin resistance marker was added to 200 ul of competent cells. The transformed competent cells were diluted 10,000 times, out of which, 50 pl was plated on agar plates containing ampicillin. A total of 35 colomes were obtained. The transformation efficiency is _ _× 10° cfu ug-1 2.8

Biomolecules, enzyme kinetics

Match the reagents in Group I with their preferred cleavage sites in Group II Group I Group II P) Cyanogen bromide 1) Carboxyl side of methionine Q) o-lodosobenzoate 2) Amino side of methionine R) Hydroxylamine 3) Carboxyl side of tryptophan S) 2-Nitro-S-thiocyanobenzoate 4) Amino side of cysteine 5) Asparagine-glycine bonds

Biomolecules, enzyme kinetics

Saccharomyces cerevisiae produces ethanol by fermentation The theoretical yield of ethanol from 2.5 g of glucose is - 8- 1.20 to 1.30l

Biomolecules, enzyme kinetics

Choose the CORRECT sequence of steps involved in cytoplast production

DNA replication, transcription, translation

Match the antibiotics in Group I with their modes of action in Group II Group I Group II P) Chloramphenicol 1) Inhibits protein synthesis by acting on 30S bosomal subunit Q) Rifampicin R) Tetracycline 3) Inhibits protein synthesis by acting on 50S ribosomal subunit 2) Interferes with DNA replication by inhibiting DNA gyrase S) Quinolone 4) Interferes with RNA polymerase activity 5) Inhibits B-lactamase activity

Biomolecules, enzyme kinetics

The diameters of a large and a small vessel are 1.62 m and 16.2 cm, respectively. The vessels are geometrically similar and operated under similar volumetric agitated power input. The mixing time in the small vessel was found to be 15 s. Determine the mixing time (in seconds) in the large vessel.

Linear Algebra

If matrix A = [[4, 2], [1, 3]], then the matrix resulting from the polynomial operation A^2 + 3A will be:

Mass transfer in bioprocesses (kLa)

Consider the following multiple sequence alignment of four DNA sequences. A A T G T A A G T C A G C T Shannon's entropy of the above alignment is 3.80 to 3.82

Biomolecules, enzyme kinetics

The K, of a novel competitive inhibitor designed against an enzyme is 2.5 uM. The enzyme was assayed in the absence or presence of the inhibitor (5 uM) under identical conditions. The Km in the presence of the inhibitor was found to be 30 uM. The Km in the absence of the inhibitor is _ HM. 10

Downstream processing (chromatography, filtration)

A heterozygous tall plant (Tt) was crossed with a homozygous dwarf plant (tt). The resultant seeds were collected. If five seeds are chosen at random then the probability (in %) that exactly two of these seeds will yield dwarf plants 1s 31.0 to 31.3

Quantitative Aptitude

Assuming random distribution of nucleotides, the average number of fragments generated upon digestion of a circular DNA of size 4.3 × 105 bp with Alul (5' -AGICT-3' ) is _ _× 103 1.6 to 1.7

Quantitative Aptitude

A synchronous culture containing 1.8 × 105 monkey kidney cells was seeded into three identical flasks. The doubling time of these cells is 24 h. After 24 h, the cells from all the three flasks were pooled and dispensed equally into each well of three 6-well plates. The number of cells in each well 2

Verbal Aptitude

An in vitro translation system can synthesize peptides in all three reading frames of the RNA template. When 5' - UCUCUCUC--(UC)UCUCUCUC - 3' was used as the template in this in vitro translation system, the synthesized peptides contained 50% each of serine and leucine. When 5' - CCUCCUCCU-(CCU)CCUCCU- 3' was used as the template, the synthesized peptides contained 33.3% each of serine, leucine, and proline. Deduce the codon for proline.

Quantitative Aptitude

Three distinct antigens X, Y and Z were used to raise antibodies. Antigen Z was injected in a njection of antigen X was administered on day 70. The antibody titers were monitored in the serut nouse on day zero followed by the administration of antigens X and Y on day 28. A secon every day and the results are shown below: 0 14 28 42 56 70 84 98 Which one of the following statements regarding the antibody titers in the serum is INCORRECT?

Quantitative Aptitude

The standard free energy change (AG'°) for ATP hydrolysis is -30 kj-mole 1. The in vivo concentrations of ATP, ADP and Pj in E. coli are 7.90, 1.04 and 7.90 mM, respectively. When E. coli cells are cultured at 37 °C, the free energy change (AG) for ATP hydrolysis in vivo is kJ- mole 1. -48 to -46

Quantitative Aptitude

In a fed-batch culture, 200 g • L~ glucose solution is added at a flow rate of 50 L-h-1. The initial culture volume (at quasi steady state) and the initial cell concentration are 600 L and 20 g • L~1 respectively. The yield coefficient (Yx/s) is 0.5 g cell mass•g substrate ~1 . The cell concentration (g • L~*) at quasi steady state at t=8 h is

Quantitative Aptitude

Cytoplasmic extract from the wild type strain of a bacterium has the ability to convert precursor S to product P via intermediates X, Y, and Z. Mutants defective in enzymes a, b, c, d show blocks at specific steps. The deduced linear pathway order is:

Quantitative Aptitude

Samples of bacterial culture taken at 5 PM and then the next day at 5 AM were found to have 10* and 10' cells mL*', respectively. Assuming that both the samples were taken during the log phase of cell growth, the generation time of this bacterium will be h. 1.20 to 1.221

Quantitative Aptitude

Biomass is being produced in a continuous stirred tank bioreactor of 750 L capacity. The sterile feed containing 8 g • L-'glucose as substrate was fed at a flow rate of 150 L • h-1. The microbial system follows Monod's model with = 1.5 \x/s = 0.5 g cell mass'g substrate ™1. Determine the cell productivity (g • L~1 • h~3) at steady state.

Quantitative Aptitude

A linear double stranded DNA of length 8 kbp has three restriction sites: one for HaeIII and two for BamHI. Digestion yields distinct fragments of 2 kb, 3 kb, 1 kb, and 2 kb. The correct physical map of the restriction sites is: