GATE BT 2015 • Q26 MCQ • 1 Mark

Section 4: Bioprocess Engineering and Process Biotechnology

Media Sterilization and Stoichiometry

Subtopic: Thermal Sterilization & Stoichiometry

Question Statement:

Identify the file format given below: >P1; JMFD Protein X - Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL

Options:

  • (A) GDE
  • (B) FASTA
  • (C) NBRF
  • (D) GCG

Official Answer Key:

C

Step-by-Step Solution & Explanation

### **Official Solution & Step-by-Step Derivation (GATE BT 2015 Q.26)** **1. Governing Concept & Syllabus Classification**: - **Section**: BT - **Question Type**: **MCQ** (1 Mark) - **Core Topic**: Biochemistry, Microbiology & Molecular Biology **2. Detailed Step-by-Step Analytical & Scientific Derivation**: - **Systematic Conceptual & Option-by-Option Evaluation**: - Problem Focus: *"Identify the file format given below: >P1; JMFD Protein X - Homo sapiens MKALTARQQEVFDLIRDHISRTLRQQGDWL..."* - **Option (C) [CORRECT]**: *"NBRF"* - Validated by canonical biochemistry/biotechnology literature. Specifically matches the molecular mechanism, kinetic model, or empirical finding required. - **Option (A) [INCORRECT]**: *"GDE"* does not satisfy the precise boundary conditions or molecular specificity. - **Option (B) [INCORRECT]**: *"FASTA"* does not satisfy the precise boundary conditions or molecular specificity. - **Option (D) [INCORRECT]**: *"GCG Options : 1. * A 2. * B 3. V C 4. * D"* does not satisfy the precise boundary conditions or molecular specificity. **3. Final Answer / Verification Summary**: - **Official GATE Answer Key**: **C** - **Scoring Criteria**: 1 Mark (Negative marking: -0.33 marks).

Practice This in Real CBT Exam Interface

Test yourself with the official TCS-iON palette, virtual calculator, and immediate performance analytics.

Launch CBT Mock Test